General Information

  • ID:  hor004010
  • Uniprot ID:  B7PV73??161-167)
  • Protein name:  Pyrokinin-3
  • Gene name:  NA
  • Organism:  Ixodes scapularis (Black-legged tick) (Deer tick)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ixodes (genus), Ixodinae (subfamily), Ixodidae (family), Ixodoidea (superfamily), Ixodida (order), Parasitiformes (superorder), Acari (subclass), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GSFTPRI
  • Length:  7(161-167)
  • Propeptide:  MGANRQLLMRAFWLQLLFSTLTLGVGGLIPFPRVGRSAGRDLGRGPEELLTLDTELGSDWAFLLLPYKRRSNNFTPRIGAKRRSVSEDGGHGDSSDMRALSRHSWPALDWSYPRMSQQMIPVPRNGRGSFVPRLGKRRMGYDDPESWDSREFSASGDPKRGSFTPRIGRAAFTPRIGRTPFTPRIGRSGDSNKDTMSNDDKAQSASGSDSNSRSSV
  • Signal peptide:  MGANRQLLMRAFWLQLLFSTLTLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B7PV73-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004010_AF2.pdbhor004010_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 88408 Formula: C35H56N10O10
Absent amino acids: ACDEHKLMNQVWY Common amino acids: FGIPRST
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -10 Boman Index: -1205
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: -220 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19540946
  • Title:  The Neuropeptidomics of Ixodes Scapularis Synganglion